PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.71XYU
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 139aa    MW: 16549.6 Da    PI: 6.9613
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.71XYUgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding285.1e-094385447
                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     WT++E+ l+ ++ ++  ++ Wk+I+++  k++  +q+ s+ qky
      Aradu.71XYU 43 WTQDEHRLFFRGYQEVSSH-WKRISEYYVKTKIFNQISSHAQKY 85
                     *******************.***********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.353590IPR017930Myb domain
SuperFamilySSF466893.59E-123691IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-103889IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.1E-44284IPR009057Homeodomain-like
PfamPF002491.3E-64385IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
TLSPLPSYST DHNHREEVVP TAEEEVVPTA QEEAAPTKTE YHWTQDEHRL FFRGYQEVSS  60
HWKRISEYYV KTKIFNQISS HAQKYFLHKK ELAKEKKLRK KIVPCFEVFN RWRRICLKEK  120
EHLSGLDDNA EGDGELDFI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015937519.11e-44PREDICTED: WAS/WASL-interacting protein family member 1-like isoform X2
RefseqXP_015937520.11e-44PREDICTED: WAS/WASL-interacting protein family member 1-like isoform X2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.24e-11MYB_related family protein